SCOPe 2.05: Domain d1hr0q_: 1hr0 Q:

Lineage for d1hr0q_ (1hr0 Q:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
   barrel, closed; n=5, S=8

6. Protein Ribosomal protein S17 [50304] (3 species)

7. Species Thermus thermophilus [TaxId:274] [50305] (45 PDB entries)
   Uniprot P24321

8. Domain d1hr0q_: 1hr0 Q: [25353]
   Other proteins in same PDB: d1hr0b_, d1hr0c1, d1hr0c2, d1hr0d_, d1hr0e1, d1hr0e2, d1hr0f_, d1hr0g_, d1hr0h_, d1hr0i_, d1hr0j_, d1hr0k_, d1hr0l_, d1hr0m_, d1hr0n_, d1hr0o_, d1hr0p_, d1hr0r_, d1hr0s_, d1hr0t_, d1hr0v_, d1hr0w_
   complexed with mg, zn

Details for d1hr0q_

PDB Entry: 1hr0, 3.2 Å

PDB Description: crystal structure of initiation factor if1 bound to the 30s ribosomal subunit

PDB Compounds: (Q:) 30S ribosomal protein S17

SCOPe Domain Sequences for d1hr0q_:

Sequence; same for both SEQRES and ATOM records:

>d1hr0q_ b.40.4.5 (Q:) Ribosomal protein S17 {Thermus thermophilus [TaxId: 274]}
pkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeekyklgdvveiie
srpiskrkrfrvlrlvesgrmdlvekylirrqnyqslskrggka

Timeline for d1hr0q_:

• d1hr0q_ first appeared (with stable ids) in SCOP 1.55
  
• d1hr0q_ appears in SCOPe 2.04
  
• d1hr0q_ appears in SCOPe 2.06
  
• d1hr0q_ appears in the current release, SCOPe 2.08