SCOPe 2.04: Domain d4l5qa2: 4l5q A:156-243

Lineage for d4l5qa2 (4l5q A:156-243)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.16: HIN-2000 domain-like [159141] (2 families)
   duplication: tandem repeat of two OB-fold domains

5. Family b.40.16.0: automated matches [233467] (1 protein)
   not a true family

6. Protein automated matches [233468] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [234954] (4 PDB entries)

8. Domain d4l5qa2: 4l5q A:156-243 [253528]
   automated match to d2oq0a1

Details for d4l5qa2

PDB Entry: 4l5q, 2.23 Å

PDB Description: Crystal structure of p202 HIN1

PDB Compounds: (A:) Interferon-activable protein 202

SCOPe Domain Sequences for d4l5qa2:

Sequence; same for both SEQRES and ATOM records:

>d4l5qa2 b.40.16.0 (A:156-243) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lkiskikeldsgtliygvfavekkkvndksitfkikdnednikvvwdkeqhninyekgdk
lqlfsfhlrkgngkpilhsgnhsfikge

Timeline for d4l5qa2:

• d4l5qa2 is new in SCOPe 2.04-stable
  
• d4l5qa2 appears in SCOPe 2.05
  
• d4l5qa2 appears in the current release, SCOPe 2.08