| Class b: All beta proteins [48724] (176 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) ![]() |
| Family b.34.9.0: automated matches [191625] (1 protein) not a true family |
| Protein automated matches [191144] (3 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [189286] (20 PDB entries) |
| Domain d4l59a3: 4l59 A:448-544 [253524] automated match to d1oz3a3 complexed with 1vz, so4, unx |
PDB Entry: 4l59 (more details), 2.29 Å
SCOPe Domain Sequences for d4l59a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l59a3 b.34.9.0 (A:448-544) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fswdkyleetnslpaparafkvkpphgfqkkmklevvdkrnpmfirvatvadtddhrvkv
hfdgwnncydywidadspdihpvgwcsktghplqppl
Timeline for d4l59a3: