Lineage for d4l59a3 (4l59 A:448-544)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1784737Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 1784908Family b.34.9.0: automated matches [191625] (1 protein)
    not a true family
  6. 1784909Protein automated matches [191144] (3 species)
    not a true protein
  7. 1784919Species Human (Homo sapiens) [TaxId:9606] [189286] (20 PDB entries)
  8. 1784989Domain d4l59a3: 4l59 A:448-544 [253524]
    automated match to d1oz3a3
    complexed with 1vz, so4, unx

Details for d4l59a3

PDB Entry: 4l59 (more details), 2.29 Å

PDB Description: crystal structure of the 3-mbt repeat domain of l3mbtl3 and unc2533 complex
PDB Compounds: (A:) Lethal(3)malignant brain tumor-like protein 3

SCOPe Domain Sequences for d4l59a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l59a3 b.34.9.0 (A:448-544) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fswdkyleetnslpaparafkvkpphgfqkkmklevvdkrnpmfirvatvadtddhrvkv
hfdgwnncydywidadspdihpvgwcsktghplqppl

SCOPe Domain Coordinates for d4l59a3:

Click to download the PDB-style file with coordinates for d4l59a3.
(The format of our PDB-style files is described here.)

Timeline for d4l59a3: