Lineage for d1fjgq_ (1fjg Q:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 373898Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 374537Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families) (S)
  5. 374797Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (17 proteins)
    barrel, closed; n=5, S=8
  6. 374907Protein Ribosomal protein S17 [50304] (2 species)
  7. 374910Species Thermus thermophilus [TaxId:274] [50305] (14 PDB entries)
  8. 374911Domain d1fjgq_: 1fjg Q: [25352]
    Other proteins in same PDB: d1fjgb_, d1fjgc1, d1fjgc2, d1fjgd_, d1fjge1, d1fjge2, d1fjgf_, d1fjgg_, d1fjgh_, d1fjgi_, d1fjgj_, d1fjgk_, d1fjgl_, d1fjgm_, d1fjgn_, d1fjgo_, d1fjgp_, d1fjgr_, d1fjgs_, d1fjgt_, d1fjgv_
    complexed with mg, par, scm, sry, zn

Details for d1fjgq_

PDB Entry: 1fjg (more details), 3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin

SCOP Domain Sequences for d1fjgq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fjgq_ b.40.4.5 (Q:) Ribosomal protein S17 {Thermus thermophilus}
pkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeekyklgdvveiie
srpiskrkrfrvlrlvesgrmdlvekylirrqnyqslskrggka

SCOP Domain Coordinates for d1fjgq_:

Click to download the PDB-style file with coordinates for d1fjgq_.
(The format of our PDB-style files is described here.)

Timeline for d1fjgq_: