![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
![]() | Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) ![]() automatically mapped to Pfam PF02777 |
![]() | Family d.44.1.0: automated matches [227155] (1 protein) not a true family |
![]() | Protein automated matches [226860] (31 species) not a true protein |
![]() | Species Pseudoalteromonas haloplanktis [TaxId:228] [237182] (3 PDB entries) |
![]() | Domain d4l2ab2: 4l2a B:83-192 [253518] Other proteins in same PDB: d4l2aa1, d4l2ab1 automated match to d4l2ca2 complexed with fe; mutant |
PDB Entry: 4l2a (more details), 2.06 Å
SCOPe Domain Sequences for d4l2ab2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l2ab2 d.44.1.0 (B:83-192) automated matches {Pseudoalteromonas haloplanktis [TaxId: 228]} ngggaptgavadainakwgsfdafkealndkavnnfgsswtwlvkladgsldivntsnaa tpltddgvtpiltvdlwehayyidyrnvrpdylkgfwslvnwefananfa
Timeline for d4l2ab2: