Lineage for d4l2ab1 (4l2a B:1-82)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2303207Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2303511Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 2303798Family a.2.11.0: automated matches [227154] (1 protein)
    not a true family
  6. 2303799Protein automated matches [226859] (38 species)
    not a true protein
  7. 2303993Species Pseudoalteromonas haloplanktis [TaxId:228] [237179] (3 PDB entries)
  8. 2304001Domain d4l2ab1: 4l2a B:1-82 [253517]
    Other proteins in same PDB: d4l2aa2, d4l2ab2
    automated match to d4l2ca1
    complexed with fe; mutant

Details for d4l2ab1

PDB Entry: 4l2a (more details), 2.06 Å

PDB Description: X-ray structure of the C57R mutant of the iron superoxide dismutase from Pseudoalteromonas haloplanktis (crystal form II)
PDB Compounds: (B:) superoxide dismutase [fe]

SCOPe Domain Sequences for d4l2ab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l2ab1 a.2.11.0 (B:1-82) automated matches {Pseudoalteromonas haloplanktis [TaxId: 228]}
afelpslpyaidalephisketlefhhgkhhntyvvklnglipgtkfenksleeivrssd
ggvfnnaaqiwnhtfywnslsp

SCOPe Domain Coordinates for d4l2ab1:

Click to download the PDB-style file with coordinates for d4l2ab1.
(The format of our PDB-style files is described here.)

Timeline for d4l2ab1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4l2ab2