Lineage for d4l29w1 (4l29 W:1-181)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1897191Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1897192Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1897193Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1897285Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species)
  7. 1897297Species Human (Homo sapiens), HLA-A2 [TaxId:9606] [54469] (2 PDB entries)
  8. 1897309Domain d4l29w1: 4l29 W:1-181 [253509]
    Other proteins in same PDB: d4l29a2, d4l29b_, d4l29c2, d4l29d_, d4l29e2, d4l29f_, d4l29g2, d4l29h_, d4l29i2, d4l29j_, d4l29k2, d4l29l_, d4l29m2, d4l29n_, d4l29o2, d4l29p_, d4l29q2, d4l29r_, d4l29s2, d4l29t_, d4l29u2, d4l29v_, d4l29w2, d4l29x_, d4l29y2, d4l29z_
    automated match to d1hlaa2
    complexed with cl, gol; mutant

Details for d4l29w1

PDB Entry: 4l29 (more details), 3.09 Å

PDB Description: Structure of wtMHC class I with NY-ESO1 double mutant
PDB Compounds: (W:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d4l29w1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l29w1 d.19.1.1 (W:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOPe Domain Coordinates for d4l29w1:

Click to download the PDB-style file with coordinates for d4l29w1.
(The format of our PDB-style files is described here.)

Timeline for d4l29w1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4l29w2