| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
| Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
| Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species) |
| Species Human (Homo sapiens), HLA-A2 [TaxId:9606] [54469] (9 PDB entries) |
| Domain d4l29s1: 4l29 S:1-181 [253503] Other proteins in same PDB: d4l29a2, d4l29b1, d4l29b2, d4l29c2, d4l29d1, d4l29d2, d4l29e2, d4l29f1, d4l29f2, d4l29g2, d4l29h1, d4l29h2, d4l29i2, d4l29j1, d4l29j2, d4l29k2, d4l29l1, d4l29l2, d4l29m2, d4l29n1, d4l29n2, d4l29o2, d4l29p1, d4l29p2, d4l29q2, d4l29r1, d4l29r2, d4l29s2, d4l29t1, d4l29t2, d4l29u2, d4l29v1, d4l29v2, d4l29w2, d4l29x1, d4l29x2, d4l29y2, d4l29z1, d4l29z2 automated match to d1hlaa2 complexed with cl, gol; mutant |
PDB Entry: 4l29 (more details), 3.09 Å
SCOPe Domain Sequences for d4l29s1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l29s1 d.19.1.1 (S:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r
Timeline for d4l29s1:
View in 3DDomains from other chains: (mouse over for more information) d4l29a1, d4l29a2, d4l29b1, d4l29b2, d4l29c1, d4l29c2, d4l29d1, d4l29d2, d4l29e1, d4l29e2, d4l29f1, d4l29f2, d4l29g1, d4l29g2, d4l29h1, d4l29h2, d4l29i1, d4l29i2, d4l29j1, d4l29j2, d4l29k1, d4l29k2, d4l29l1, d4l29l2, d4l29m1, d4l29m2, d4l29n1, d4l29n2, d4l29o1, d4l29o2, d4l29p1, d4l29p2, d4l29q1, d4l29q2, d4l29r1, d4l29r2, d4l29t1, d4l29t2, d4l29u1, d4l29u2, d4l29v1, d4l29v2, d4l29w1, d4l29w2, d4l29x1, d4l29x2, d4l29y1, d4l29y2, d4l29z1, d4l29z2 |