![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) ![]() |
![]() | Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins) barrel, closed; n=5, S=8 |
![]() | Protein Ribosomal protein S12 [50302] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [50303] (36 PDB entries) Uniprot P17293 |
![]() | Domain d1hnxl_: 1hnx L: [25350] Other proteins in same PDB: d1hnxb_, d1hnxc1, d1hnxc2, d1hnxd_, d1hnxe1, d1hnxe2, d1hnxf_, d1hnxg_, d1hnxh_, d1hnxi_, d1hnxj_, d1hnxk_, d1hnxm_, d1hnxn_, d1hnxo_, d1hnxp_, d1hnxq_, d1hnxr_, d1hnxs_, d1hnxt_, d1hnxv_ complexed with mg, pcy, zn |
PDB Entry: 1hnx (more details), 3.4 Å
SCOPe Domain Sequences for d1hnxl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hnxl_ b.40.4.5 (L:) Ribosomal protein S12 {Thermus thermophilus [TaxId: 274]} ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk pkea
Timeline for d1hnxl_: