Lineage for d4l29m2 (4l29 M:182-276)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1514415Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 1514416Species Human (Homo sapiens) [TaxId:9606] [88605] (187 PDB entries)
    Uniprot P30685 25-300 ! Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor ! Uniprot P30481 25-300 ! Uniprot P01892 25-298 ! Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor
  8. 1514673Domain d4l29m2: 4l29 M:182-276 [253495]
    Other proteins in same PDB: d4l29a1, d4l29b_, d4l29c1, d4l29d_, d4l29e1, d4l29f_, d4l29g1, d4l29h_, d4l29i1, d4l29j_, d4l29k1, d4l29l_, d4l29m1, d4l29n_, d4l29o1, d4l29p_, d4l29q1, d4l29r_, d4l29s1, d4l29t_, d4l29u1, d4l29v_, d4l29w1, d4l29x_, d4l29y1, d4l29z_
    automated match to d1ogaa1
    complexed with cl, gol; mutant

Details for d4l29m2

PDB Entry: 4l29 (more details), 3.09 Å

PDB Description: Structure of wtMHC class I with NY-ESO1 double mutant
PDB Compounds: (M:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d4l29m2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l29m2 b.1.1.2 (M:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwep

SCOPe Domain Coordinates for d4l29m2:

Click to download the PDB-style file with coordinates for d4l29m2.
(The format of our PDB-style files is described here.)

Timeline for d4l29m2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4l29m1