SCOPe 2.04: Domain d4l29k2: 4l29 K:182-276

Lineage for d4l29k2 (4l29 K:182-276)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88605] (187 PDB entries)
   Uniprot P30685 25-300 ! Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor ! Uniprot P30481 25-300 ! Uniprot P01892 25-298 ! Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor

8. Domain d4l29k2: 4l29 K:182-276 [253492]
   Other proteins in same PDB: d4l29a1, d4l29b_, d4l29c1, d4l29d_, d4l29e1, d4l29f_, d4l29g1, d4l29h_, d4l29i1, d4l29j_, d4l29k1, d4l29l_, d4l29m1, d4l29n_, d4l29o1, d4l29p_, d4l29q1, d4l29r_, d4l29s1, d4l29t_, d4l29u1, d4l29v_, d4l29w1, d4l29x_, d4l29y1, d4l29z_
   automated match to d1ogaa1
   complexed with cl, gol; mutant

Details for d4l29k2

PDB Entry: 4l29, 3.09 Å

PDB Description: Structure of wtMHC class I with NY-ESO1 double mutant

PDB Compounds: (K:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d4l29k2:

Sequence; same for both SEQRES and ATOM records:

>d4l29k2 b.1.1.2 (K:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwep

Timeline for d4l29k2:

• d4l29k2 is new in SCOPe 2.04-stable
  
• d4l29k2 appears in SCOPe 2.05
  
• d4l29k2 appears in the current release, SCOPe 2.08