![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Class I MHC, alpha-3 domain [88604] (4 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88605] (187 PDB entries) Uniprot P30685 25-300 ! Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor ! Uniprot P30481 25-300 ! Uniprot P01892 25-298 ! Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor |
![]() | Domain d4l29k2: 4l29 K:182-276 [253492] Other proteins in same PDB: d4l29a1, d4l29b_, d4l29c1, d4l29d_, d4l29e1, d4l29f_, d4l29g1, d4l29h_, d4l29i1, d4l29j_, d4l29k1, d4l29l_, d4l29m1, d4l29n_, d4l29o1, d4l29p_, d4l29q1, d4l29r_, d4l29s1, d4l29t_, d4l29u1, d4l29v_, d4l29w1, d4l29x_, d4l29y1, d4l29z_ automated match to d1ogaa1 complexed with cl, gol; mutant |
PDB Entry: 4l29 (more details), 3.09 Å
SCOPe Domain Sequences for d4l29k2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l29k2 b.1.1.2 (K:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf qkwaavvvpsgqeqrytchvqheglpkpltlrwep
Timeline for d4l29k2:
![]() Domains from other chains: (mouse over for more information) d4l29a1, d4l29a2, d4l29b_, d4l29c1, d4l29c2, d4l29d_, d4l29e1, d4l29e2, d4l29f_, d4l29g1, d4l29g2, d4l29h_, d4l29i1, d4l29i2, d4l29j_, d4l29l_, d4l29m1, d4l29m2, d4l29n_, d4l29o1, d4l29o2, d4l29p_, d4l29q1, d4l29q2, d4l29r_, d4l29s1, d4l29s2, d4l29t_, d4l29u1, d4l29u2, d4l29v_, d4l29w1, d4l29w2, d4l29x_, d4l29y1, d4l29y2, d4l29z_ |