Lineage for d1hnwl_ (1hnw L:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 667292Fold b.40: OB-fold [50198] (12 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 668013Superfamily b.40.4: Nucleic acid-binding proteins [50249] (14 families) (S)
  5. 668307Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (22 proteins)
    barrel, closed; n=5, S=8
  6. 668483Protein Ribosomal protein S12 [50302] (1 species)
  7. 668484Species Thermus thermophilus [TaxId:274] [50303] (36 PDB entries)
  8. 668496Domain d1hnwl_: 1hnw L: [25349]
    Other proteins in same PDB: d1hnwb_, d1hnwc1, d1hnwc2, d1hnwd_, d1hnwe1, d1hnwe2, d1hnwf_, d1hnwg_, d1hnwh_, d1hnwi_, d1hnwj_, d1hnwk_, d1hnwm_, d1hnwn_, d1hnwo_, d1hnwp_, d1hnwq_, d1hnwr_, d1hnws_, d1hnwt_, d1hnwv_
    complexed with mg, tac, zn

Details for d1hnwl_

PDB Entry: 1hnw (more details), 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline
PDB Compounds: (L:) 30S ribosomal protein S12

SCOP Domain Sequences for d1hnwl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnwl_ b.40.4.5 (L:) Ribosomal protein S12 {Thermus thermophilus [TaxId: 274]}
ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk
pkea

SCOP Domain Coordinates for d1hnwl_:

Click to download the PDB-style file with coordinates for d1hnwl_.
(The format of our PDB-style files is described here.)

Timeline for d1hnwl_: