Lineage for d4kzka_ (4kzk A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1624506Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 1624507Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 1624744Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. 1624745Protein automated matches [190646] (49 species)
    not a true protein
  7. 1624800Species Burkholderia thailandensis [TaxId:271848] [225530] (2 PDB entries)
  8. 1624801Domain d4kzka_: 4kzk A: [253473]
    automated match to d8abpa_
    complexed with gal

Details for d4kzka_

PDB Entry: 4kzk (more details), 1.5 Å

PDB Description: the structure of the periplasmic l-arabinose binding protein from burkholderia thailandensis
PDB Compounds: (A:) L-arabinose ABC transporter, periplasmic L-arabinose-binding protein

SCOPe Domain Sequences for d4kzka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kzka_ c.93.1.0 (A:) automated matches {Burkholderia thailandensis [TaxId: 271848]}
vkigfvvkqpddpwfqdewrfaeqaakdkhftlvkiaapsgekvstaldslaaqkaqgvi
icapdvklgpgiaakakrygmklmsvddqlvdgrgapladvphmgisayrigrqvgdaia
aeakrrgwnpaevgvlrlaydqlptarerttgavdalkaagfaaanvvdapemtadtega
fnaaniaftkhrnfrhwvafgsnddttvgavragegrgigtddmiavgingsqvalnefa
kpkptgffgsillnprlhgydtsvnmydwitqnrtppplvltsgtlitranektaraqlg
l

SCOPe Domain Coordinates for d4kzka_:

Click to download the PDB-style file with coordinates for d4kzka_.
(The format of our PDB-style files is described here.)

Timeline for d4kzka_: