![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
![]() | Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) ![]() Similar in architecture to the superfamily II but partly differs in topology |
![]() | Family c.93.1.0: automated matches [191439] (1 protein) not a true family |
![]() | Protein automated matches [190646] (77 species) not a true protein |
![]() | Species Burkholderia thailandensis [TaxId:271848] [225530] (2 PDB entries) |
![]() | Domain d4kzka_: 4kzk A: [253473] automated match to d8abpa_ complexed with gal |
PDB Entry: 4kzk (more details), 1.5 Å
SCOPe Domain Sequences for d4kzka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kzka_ c.93.1.0 (A:) automated matches {Burkholderia thailandensis [TaxId: 271848]} vkigfvvkqpddpwfqdewrfaeqaakdkhftlvkiaapsgekvstaldslaaqkaqgvi icapdvklgpgiaakakrygmklmsvddqlvdgrgapladvphmgisayrigrqvgdaia aeakrrgwnpaevgvlrlaydqlptarerttgavdalkaagfaaanvvdapemtadtega fnaaniaftkhrnfrhwvafgsnddttvgavragegrgigtddmiavgingsqvalnefa kpkptgffgsillnprlhgydtsvnmydwitqnrtppplvltsgtlitranektaraqlg l
Timeline for d4kzka_: