Lineage for d4kysa_ (4kys A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2145531Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2145532Protein automated matches [190039] (138 species)
    not a true protein
  7. 2145680Species Clostridium botulinum [TaxId:441770] [256351] (1 PDB entry)
  8. 2145681Domain d4kysa_: 4kys A: [253470]
    automated match to d3thia_
    complexed with cit, mg, vib

Details for d4kysa_

PDB Entry: 4kys (more details), 2.18 Å

PDB Description: Clostridium botulinum thiaminase I in complex with thiamin
PDB Compounds: (A:) Thiamine pyridinylase I

SCOPe Domain Sequences for d4kysa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kysa_ c.94.1.0 (A:) automated matches {Clostridium botulinum [TaxId: 441770]}
qtlnvalyeyvpdpirfkkavetewnkkepniklnfvdwdcysedppkdldvfvfdavyl
shfvkegylseipekdiknkedilpfamegctikgsayaipqiistnllfsrkgdydiqk
vnsvydlydklgkftsediilpnnkgllidmsggtskacmyldslidttqeytkfcslpn
lnelnkdaieslvllqsmagksqanywpenndsyirakwfingkgrayigyteamsqmke
fandidfktislsknsnipifygdvvginssitnsykkekaielaniitdkntmvkavsp
dennkypqyllparrsvyhnlgnkypiygklykiadnsnnklfrtgpeirewlkqakkii
teylqq

SCOPe Domain Coordinates for d4kysa_:

Click to download the PDB-style file with coordinates for d4kysa_.
(The format of our PDB-style files is described here.)

Timeline for d4kysa_: