Lineage for d4ky8d2 (4ky8 D:193-521)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2536167Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2536168Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2536169Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2536170Protein Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, TS domain [55841] (2 species)
  7. 2536171Species Cryptosporidium hominis [TaxId:237895] [100887] (4 PDB entries)
  8. 2536190Domain d4ky8d2: 4ky8 D:193-521 [253467]
    Other proteins in same PDB: d4ky8a1, d4ky8b1, d4ky8c1, d4ky8d1, d4ky8e1
    automated match to d1qzfa2
    complexed with 1uf, mtx, ndp, ufp

Details for d4ky8d2

PDB Entry: 4ky8 (more details), 3.08 Å

PDB Description: crystal structure of ts-dhfr from cryptosporidium hominis in complex with nadph, methotrexate, fdump and 4-((2-amino-6-methyl-4-oxo-4,7- dihydro-3h-pyrrolo[2,3-d]pyrimidin-5-yl)thio)-2-chlorophenyl)-l- glutamic acid
PDB Compounds: (D:) Bifunctional thymidylate synthase-dihydrofolate reductase

SCOPe Domain Sequences for d4ky8d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ky8d2 d.117.1.1 (D:193-521) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, TS domain {Cryptosporidium hominis [TaxId: 237895]}
lksiddtvdllgeifgirkmgnrhkfpkeeiyntpsirfgrehyefqyldllsrvlenga
yrenrtgistysifgqmmrfdmresfpllttkkvairsifeeliwfikgdtngnhliekk
vyiwsgngskeyleriglghreendlgpiygfqwrhyngeyktmhddytgvgvdqlakli
etlknnpkdrrhiltawnpsalsqmalppchvlsqyyvtndnclscnlyqrscdlglgsp
fniasyailtmmlaqvcgyepgelaifigdahiyenhltqlkeqlsrtprpfpqlkfkrk
veniedfkwedieligyypyptikmdmav

SCOPe Domain Coordinates for d4ky8d2:

Click to download the PDB-style file with coordinates for d4ky8d2.
(The format of our PDB-style files is described here.)

Timeline for d4ky8d2: