| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) ![]() |
| Family c.71.1.0: automated matches [191485] (1 protein) not a true family |
| Protein automated matches [190777] (17 species) not a true protein |
| Species Cryptosporidium hominis [TaxId:237895] [231999] (4 PDB entries) |
| Domain d4ky8c1: 4ky8 C:3-178 [253464] Other proteins in same PDB: d4ky8a2, d4ky8b2, d4ky8c2, d4ky8d2, d4ky8e2 automated match to d1qzfa1 complexed with 1uf, mtx, ndp, ufp |
PDB Entry: 4ky8 (more details), 3.08 Å
SCOPe Domain Sequences for d4ky8c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ky8c1 c.71.1.0 (C:3-178) automated matches {Cryptosporidium hominis [TaxId: 237895]}
eknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwdsi
grrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyrda
lkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekq
Timeline for d4ky8c1: