Lineage for d4ky8b2 (4ky8 B:193-521)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1666639Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 1666640Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 1666641Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 1666899Protein automated matches [190469] (12 species)
    not a true protein
  7. 1666907Species Cryptosporidium hominis [TaxId:237895] [232024] (4 PDB entries)
  8. 1666917Domain d4ky8b2: 4ky8 B:193-521 [253463]
    Other proteins in same PDB: d4ky8a1, d4ky8b1, d4ky8c1, d4ky8d1, d4ky8e1
    automated match to d1qzfa2
    complexed with 1uf, mtx, ndp, ufp

Details for d4ky8b2

PDB Entry: 4ky8 (more details), 3.08 Å

PDB Description: crystal structure of ts-dhfr from cryptosporidium hominis in complex with nadph, methotrexate, fdump and 4-((2-amino-6-methyl-4-oxo-4,7- dihydro-3h-pyrrolo[2,3-d]pyrimidin-5-yl)thio)-2-chlorophenyl)-l- glutamic acid
PDB Compounds: (B:) Bifunctional thymidylate synthase-dihydrofolate reductase

SCOPe Domain Sequences for d4ky8b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ky8b2 d.117.1.1 (B:193-521) automated matches {Cryptosporidium hominis [TaxId: 237895]}
lksiddtvdllgeifgirkmgnrhkfpkeeiyntpsirfgrehyefqyldllsrvlenga
yrenrtgistysifgqmmrfdmresfpllttkkvairsifeeliwfikgdtngnhliekk
vyiwsgngskeyleriglghreendlgpiygfqwrhyngeyktmhddytgvgvdqlakli
etlknnpkdrrhiltawnpsalsqmalppchvlsqyyvtndnclscnlyqrscdlglgsp
fniasyailtmmlaqvcgyepgelaifigdahiyenhltqlkeqlsrtprpfpqlkfkrk
veniedfkwedieligyypyptikmdmav

SCOPe Domain Coordinates for d4ky8b2:

Click to download the PDB-style file with coordinates for d4ky8b2.
(The format of our PDB-style files is described here.)

Timeline for d4ky8b2: