SCOPe 2.05: Domain d4ky8b1: 4ky8 B:3-178

Lineage for d4ky8b1 (4ky8 B:3-178)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.0: automated matches [191485] (1 protein)
   not a true family

6. Protein automated matches [190777] (19 species)
   not a true protein

7. Species Cryptosporidium hominis [TaxId:237895] [231999] (4 PDB entries)

8. Domain d4ky8b1: 4ky8 B:3-178 [253462]
   Other proteins in same PDB: d4ky8a2, d4ky8b2, d4ky8c2, d4ky8d2, d4ky8e2
   automated match to d1qzfa1
   complexed with 1uf, mtx, ndp, ufp

Details for d4ky8b1

PDB Entry: 4ky8, 3.08 Å

PDB Description: crystal structure of ts-dhfr from cryptosporidium hominis in complex with nadph, methotrexate, fdump and 4-((2-amino-6-methyl-4-oxo-4,7- dihydro-3h-pyrrolo[2,3-d]pyrimidin-5-yl)thio)-2-chlorophenyl)-l- glutamic acid

PDB Compounds: (B:) Bifunctional thymidylate synthase-dihydrofolate reductase

SCOPe Domain Sequences for d4ky8b1:

Sequence; same for both SEQRES and ATOM records:

>d4ky8b1 c.71.1.0 (B:3-178) automated matches {Cryptosporidium hominis [TaxId: 237895]}
eknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwdsi
grrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyrda
lkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekq

Timeline for d4ky8b1:

• d4ky8b1 first appeared in SCOPe 2.04
  
• d4ky8b1 appears in SCOPe 2.06
  
• d4ky8b1 appears in the current release, SCOPe 2.08