Lineage for d4ky8b1 (4ky8 B:3-178)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1871769Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 1871770Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 1872191Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 1872192Protein automated matches [190777] (19 species)
    not a true protein
  7. 1872314Species Cryptosporidium hominis [TaxId:237895] [231999] (4 PDB entries)
  8. 1872326Domain d4ky8b1: 4ky8 B:3-178 [253462]
    Other proteins in same PDB: d4ky8a2, d4ky8b2, d4ky8c2, d4ky8d2, d4ky8e2
    automated match to d1qzfa1
    complexed with 1uf, mtx, ndp, ufp

Details for d4ky8b1

PDB Entry: 4ky8 (more details), 3.08 Å

PDB Description: crystal structure of ts-dhfr from cryptosporidium hominis in complex with nadph, methotrexate, fdump and 4-((2-amino-6-methyl-4-oxo-4,7- dihydro-3h-pyrrolo[2,3-d]pyrimidin-5-yl)thio)-2-chlorophenyl)-l- glutamic acid
PDB Compounds: (B:) Bifunctional thymidylate synthase-dihydrofolate reductase

SCOPe Domain Sequences for d4ky8b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ky8b1 c.71.1.0 (B:3-178) automated matches {Cryptosporidium hominis [TaxId: 237895]}
eknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwdsi
grrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyrda
lkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekq

SCOPe Domain Coordinates for d4ky8b1:

Click to download the PDB-style file with coordinates for d4ky8b1.
(The format of our PDB-style files is described here.)

Timeline for d4ky8b1: