SCOPe 2.05: Domain d4kw6a_: 4kw6 A:

Lineage for d4kw6a_ (4kw6 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)

6. Protein automated matches [190100] (17 species)
   not a true protein

7. Species Ancylostoma ceylanicum [TaxId:53326] [197299] (2 PDB entries)

8. Domain d4kw6a_: 4kw6 A: [253452]
   automated match to d4fh8a_
   complexed with qdo; mutant

Details for d4kw6a_

PDB Entry: 4kw6, 3 Å

PDB Description: Crystal structure of Peroxiredoxin-1 (C-terminal truncation mutant) from the human hookworm Ancylostoma ceylanicum bound to conoidin A

PDB Compounds: (A:) Peroxiredoxin-1

SCOPe Domain Sequences for d4kw6a_:

Sequence; same for both SEQRES and ATOM records:

>d4kw6a_ c.47.1.10 (A:) automated matches {Ancylostoma ceylanicum [TaxId: 53326]}
hmskafigkpapdfatkavfdgdfvdvklsdykgkyvvlffypldftfvcpteiiafsdr
fpefknlnvavlacstdsvfshlawintprkhgglgdmkipvladtnhqiakdygvlkdd
egiayrglfiidpkgilrqitindlpvgrsvdetlrlvqafqytdkhgevcp

Timeline for d4kw6a_:

• d4kw6a_ first appeared in SCOPe 2.04
  
• d4kw6a_ is called d4kw6a1 in SCOPe 2.06
  
• d4kw6a_ appears in the current release, SCOPe 2.08, called d4kw6a1