Lineage for d4kvna2 (4kvn A:355-517)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1969577Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1969578Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1969579Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1969953Protein automated matches [254646] (33 species)
    not a true protein
  7. 1970214Species Influenza A virus [TaxId:654811] [256349] (1 PDB entry)
  8. 1970215Domain d4kvna2: 4kvn A:355-517 [253449]
    Other proteins in same PDB: d4kvna1, d4kvnl1, d4kvnl2
    automated match to d1ha0a2
    complexed with nag, pge, po4

Details for d4kvna2

PDB Entry: 4kvn (more details), 3.1 Å

PDB Description: crystal structure of fab 39.29 in complex with influenza hemagglutinin a/perth/16/2009 (h3n2)
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d4kvna2:

Sequence, based on SEQRES records: (download)

>d4kvna2 h.3.1.1 (A:355-517) automated matches {Influenza A virus [TaxId: 654811]}
iengwegmvdgwygfrhqnsegrgqaadlkstqaaidqingklnrligktnekfhqieke
fsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfektkkqlren
aedmgngcfkiyhkcdnacigsirngtydhdvyrdealnnrfq

Sequence, based on observed residues (ATOM records): (download)

>d4kvna2 h.3.1.1 (A:355-517) automated matches {Influenza A virus [TaxId: 654811]}
iengwegmvdgwygfrhqnsegrgqaadlkstqaaidqingklnrligktnekfhqieke
fekyvedtkidlwsynaellvalenqhtidltdsemnklfektkkqlrenaedmgngcfk
iyhkcdnacigsirngtydhdvyrdealnnrfq

SCOPe Domain Coordinates for d4kvna2:

Click to download the PDB-style file with coordinates for d4kvna2.
(The format of our PDB-style files is described here.)

Timeline for d4kvna2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4kvna1