Lineage for d4kvna1 (4kvn A:27-343)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1778087Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1778088Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1778135Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1778136Protein Hemagglutinin [49824] (7 species)
    includes rudiment esterase domain
  7. 1778153Species Influenza A virus, different strains [TaxId:11320] [49825] (105 PDB entries)
  8. 1778348Domain d4kvna1: 4kvn A:27-343 [253448]
    Other proteins in same PDB: d4kvna2, d4kvnl1, d4kvnl2
    automated match to d1ha0a1
    complexed with nag, pge, po4

Details for d4kvna1

PDB Entry: 4kvn (more details), 3.1 Å

PDB Description: crystal structure of fab 39.29 in complex with influenza hemagglutinin a/perth/16/2009 (h3n2)
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d4kvna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kvna1 b.19.1.2 (A:27-343) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
atlclghhavpngtivktitndqievtnatelvqssstgeicdsphqildgknctlidal
lgdpqcdgfqnkkwdlfverskaysncypydvpdyaslrslvassgtlefnnesfnwtgv
tqngtssacirrsknsffsrlnwlthlnfkypalnvtmpnneqfdklyiwgvhhpgtdkd
qiflyaqasgritvstkrsqqtvspnigsrprvrnipsrisiywtivkpgdillinstgn
liaprgyfkirsgkssimrsdapigkcnsecitpngsipndkpfqnvnritygacpryvk
qntlklatgmrnvpekq

SCOPe Domain Coordinates for d4kvna1:

Click to download the PDB-style file with coordinates for d4kvna1.
(The format of our PDB-style files is described here.)

Timeline for d4kvna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4kvna2