![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) ![]() |
![]() | Family b.82.3.0: automated matches [227198] (1 protein) not a true family |
![]() | Protein automated matches [226927] (11 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [256346] (3 PDB entries) |
![]() | Domain d4ku8c_: 4ku8 C: [253447] automated match to d1u12b_ complexed with gly |
PDB Entry: 4ku8 (more details), 1.99 Å
SCOPe Domain Sequences for d4ku8c_:
Sequence, based on SEQRES records: (download)
>d4ku8c_ b.82.3.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gstglikhteymeflksvptfqslpeeilskladvleethyengeyiirqgargdtffii skgtvnvtredspsedpvflrtlgkgdwfgekalqgedvrtanviaaeavtclvidrdsf khliggld
>d4ku8c_ b.82.3.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gstglikhteymeflksvptfqslpeeilskladvleethyengeyiirqgargdtffii skgtvnvtredvflrtlgkgdwfgekalqgedvrtanviaaeavtclvidrdsfkhligg ld
Timeline for d4ku8c_: