Lineage for d4ku8b_ (4ku8 B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2403751Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2405483Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 2405722Family b.82.3.0: automated matches [227198] (1 protein)
    not a true family
  6. 2405723Protein automated matches [226927] (16 species)
    not a true protein
  7. 2405748Species Human (Homo sapiens) [TaxId:9606] [256346] (16 PDB entries)
  8. 2405766Domain d4ku8b_: 4ku8 B: [253446]
    Other proteins in same PDB: d4ku8c2
    automated match to d1u12b_
    complexed with gly

Details for d4ku8b_

PDB Entry: 4ku8 (more details), 1.99 Å

PDB Description: structures of pkgi reveal a cgmp-selective activation mechanism
PDB Compounds: (B:) cGMP-dependent protein kinase 1

SCOPe Domain Sequences for d4ku8b_:

Sequence, based on SEQRES records: (download)

>d4ku8b_ b.82.3.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
teymeflksvptfqslpeeilskladvleethyengeyiirqgargdtffiiskgtvnvt
redspsedpvflrtlgkgdwfgekalqgedvrtanviaaeavtclvidrdsfkh

Sequence, based on observed residues (ATOM records): (download)

>d4ku8b_ b.82.3.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
teymeflksvpeeilskladvleethyengeyiirqgargdtffiiskgtvnvtredsps
edpvflrtlgkgdwfgekalqgedvrtanviaaeavtclvidrdsfkh

SCOPe Domain Coordinates for d4ku8b_:

Click to download the PDB-style file with coordinates for d4ku8b_.
(The format of our PDB-style files is described here.)

Timeline for d4ku8b_: