Lineage for d4ktyb3 (4kty B:516-627)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1768856Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (2 families) (S)
    automatically mapped to Pfam PF00927
  5. 1768935Family b.1.5.0: automated matches [254331] (1 protein)
    not a true family
  6. 1768936Protein automated matches [254755] (1 species)
    not a true protein
  7. 1768937Species Human (Homo sapiens) [TaxId:9606] [256348] (1 PDB entry)
  8. 1768940Domain d4ktyb3: 4kty B:516-627 [253443]
    Other proteins in same PDB: d4ktya1, d4ktya2, d4ktyb1, d4ktyb2
    automated match to d1ex0a2
    complexed with ca, gol, so4

Details for d4ktyb3

PDB Entry: 4kty (more details), 1.98 Å

PDB Description: Fibrin-stabilizing factor with a bound ligand
PDB Compounds: (B:) coagulation factor xiii a chain

SCOPe Domain Sequences for d4ktyb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ktyb3 b.1.5.0 (B:516-627) automated matches {Human (Homo sapiens) [TaxId: 9606]}
snvdmdfevenavlgkdfklsitfrnnshnrytitaylsanitfytgvpkaefkketfdv
tleplsfkkeavliqageymgqlleqaslhffvtarinetrdvlakqkstvl

SCOPe Domain Coordinates for d4ktyb3:

Click to download the PDB-style file with coordinates for d4ktyb3.
(The format of our PDB-style files is described here.)

Timeline for d4ktyb3: