Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (2 families) automatically mapped to Pfam PF00927 |
Family b.1.5.0: automated matches [254331] (1 protein) not a true family |
Protein automated matches [254755] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [256348] (1 PDB entry) |
Domain d4ktya4: 4kty A:628-725 [253440] Other proteins in same PDB: d4ktya1, d4ktya2, d4ktyb1, d4ktyb2 automated match to d1ex0a3 complexed with ca, gol, so4 |
PDB Entry: 4kty (more details), 1.98 Å
SCOPe Domain Sequences for d4ktya4:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ktya4 b.1.5.0 (A:628-725) automated matches {Human (Homo sapiens) [TaxId: 9606]} tipeiiikvrgtqvvgsdmtviveftnplketlrnvwvhldgpgvtrpmkkmfreirpns tvqweevcrpwvsghrkliasmssdslrhvygeldvqi
Timeline for d4ktya4:
View in 3D Domains from other chains: (mouse over for more information) d4ktyb1, d4ktyb2, d4ktyb3, d4ktyb4 |