![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (2 families) ![]() automatically mapped to Pfam PF00927 |
![]() | Family b.1.5.0: automated matches [254331] (1 protein) not a true family |
![]() | Protein automated matches [254755] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [256348] (1 PDB entry) |
![]() | Domain d4ktya3: 4kty A:516-627 [253439] Other proteins in same PDB: d4ktya1, d4ktya2, d4ktyb1, d4ktyb2 automated match to d1ex0a2 complexed with ca, gol, so4 |
PDB Entry: 4kty (more details), 1.98 Å
SCOPe Domain Sequences for d4ktya3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ktya3 b.1.5.0 (A:516-627) automated matches {Human (Homo sapiens) [TaxId: 9606]} snvdmdfevenavlgkdfklsitfrnnshnrytitaylsanitfytgvpkaefkketfdv tleplsfkkeavliqageymgqlleqaslhffvtarinetrdvlakqkstvl
Timeline for d4ktya3:
![]() Domains from other chains: (mouse over for more information) d4ktyb1, d4ktyb2, d4ktyb3, d4ktyb4 |