Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.4: Transglutaminase core [54044] (3 proteins) |
Protein automated matches [190634] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [256347] (1 PDB entry) |
Domain d4ktya2: 4kty A:191-501 [253438] Other proteins in same PDB: d4ktya1, d4ktya3, d4ktya4, d4ktyb1, d4ktyb3, d4ktyb4 automated match to d1evua4 complexed with ca, gol, so4 |
PDB Entry: 4kty (more details), 1.98 Å
SCOPe Domain Sequences for d4ktya2:
Sequence, based on SEQRES records: (download)
>d4ktya2 d.3.1.4 (A:191-501) automated matches {Human (Homo sapiens) [TaxId: 9606]} davyldnekereeyvlndigvifygevndiktrswsygqfedgildtclyvmdraqmdls grgnpikvsrvgsamvnakddegvlvgswdniyaygvppsawtgsvdilleyrssenpvr ygqcwvfagvfntflrclgiparivtnyfsahdndanlqmdifleedgnvnskltkdsvw nyhcwneawmtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhghvcfqfdapf vfaevnsdliyitakkdgthvvenvdathigklivtkqiggdgmmditdtykfqegqeee rlaletalmyg
>d4ktya2 d.3.1.4 (A:191-501) automated matches {Human (Homo sapiens) [TaxId: 9606]} davyldnekereeyvlndigvifygevndiktrswsygqfedgildtclyvmdraqmdls grgnpikvsrvgsamvnakddegvlvgswdniyaygvppsawtgsvdilleyrssenpvr ygqcwvfagvfntflrclgiparivtnyfsahdndanlqmdifleedgnvnskltkdsvw nyhcwneawmtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhghvcfqfdapf vfaevnsdliyitakkthvvenvdathigklivtkqiggdgmmditdtykfqegqeeerl aletalmyg
Timeline for d4ktya2:
View in 3D Domains from other chains: (mouse over for more information) d4ktyb1, d4ktyb2, d4ktyb3, d4ktyb4 |