Lineage for d4ktya2 (4kty A:191-501)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2154577Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2154578Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2155058Family d.3.1.4: Transglutaminase core [54044] (3 protein domains)
  6. 2155118Protein automated matches [190634] (3 species)
    not a true protein
  7. 2155121Species Human (Homo sapiens) [TaxId:9606] [256347] (1 PDB entry)
  8. 2155122Domain d4ktya2: 4kty A:191-501 [253438]
    Other proteins in same PDB: d4ktya1, d4ktya3, d4ktya4, d4ktyb1, d4ktyb3, d4ktyb4
    automated match to d1evua4
    complexed with ca, gol, so4

Details for d4ktya2

PDB Entry: 4kty (more details), 1.98 Å

PDB Description: Fibrin-stabilizing factor with a bound ligand
PDB Compounds: (A:) coagulation factor xiii a chain

SCOPe Domain Sequences for d4ktya2:

Sequence, based on SEQRES records: (download)

>d4ktya2 d.3.1.4 (A:191-501) automated matches {Human (Homo sapiens) [TaxId: 9606]}
davyldnekereeyvlndigvifygevndiktrswsygqfedgildtclyvmdraqmdls
grgnpikvsrvgsamvnakddegvlvgswdniyaygvppsawtgsvdilleyrssenpvr
ygqcwvfagvfntflrclgiparivtnyfsahdndanlqmdifleedgnvnskltkdsvw
nyhcwneawmtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhghvcfqfdapf
vfaevnsdliyitakkdgthvvenvdathigklivtkqiggdgmmditdtykfqegqeee
rlaletalmyg

Sequence, based on observed residues (ATOM records): (download)

>d4ktya2 d.3.1.4 (A:191-501) automated matches {Human (Homo sapiens) [TaxId: 9606]}
davyldnekereeyvlndigvifygevndiktrswsygqfedgildtclyvmdraqmdls
grgnpikvsrvgsamvnakddegvlvgswdniyaygvppsawtgsvdilleyrssenpvr
ygqcwvfagvfntflrclgiparivtnyfsahdndanlqmdifleedgnvnskltkdsvw
nyhcwneawmtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhghvcfqfdapf
vfaevnsdliyitakkthvvenvdathigklivtkqiggdgmmditdtykfqegqeeerl
aletalmyg

SCOPe Domain Coordinates for d4ktya2:

Click to download the PDB-style file with coordinates for d4ktya2.
(The format of our PDB-style files is described here.)

Timeline for d4ktya2: