![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
![]() | Protein automated matches [190226] (39 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186988] (9 PDB entries) |
![]() | Domain d4ktya1: 4kty A:15-190 [253437] Other proteins in same PDB: d4ktya2, d4ktya3, d4ktya4, d4ktyb2, d4ktyb3, d4ktyb4 automated match to d1evua1 complexed with ca, gol, so4 |
PDB Entry: 4kty (more details), 1.98 Å
SCOPe Domain Sequences for d4ktya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ktya1 b.1.18.0 (A:15-190) automated matches {Human (Homo sapiens) [TaxId: 9606]} ppnnsnaaeddlptvelqgvvprgvnlqeflnvtsvhlfkerwdtnkvdhhtdkyennkl ivrrgqsfyvqidfsrpydprrdlfrveyvigrypqenkgtyipvpivselqsgkwgaki vmredrsvrlsiqsspkcivgkfrmyvavwtpygvlrtsrnpetdtyilfnpwced
Timeline for d4ktya1:
![]() Domains from other chains: (mouse over for more information) d4ktyb1, d4ktyb2, d4ktyb3, d4ktyb4 |