![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
![]() | Protein Ubiquitin [54238] (9 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54239] (312 PDB entries) Uniprot P62988 identical sequence in many other species |
![]() | Domain d4kslt1: 4ksl T:1-76 [253430] automated match to d4auqc_ |
PDB Entry: 4ksl (more details), 2.83 Å
SCOPe Domain Sequences for d4kslt1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kslt1 d.15.1.1 (T:1-76) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn iqkestlhlvlrlrgg
Timeline for d4kslt1: