SCOPe 2.05: Domain d1rl2a2: 1rl2 A:60-125

Lineage for d1rl2a2 (1rl2 A:60-125)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
   barrel, closed; n=5, S=8

6. Protein N-terminal domain of ribosomal protein L2 [50299] (5 species)
   incomplete OB-fold lacking the last strand

7. Species Bacillus stearothermophilus [TaxId:1422] [50300] (1 PDB entry)

8. Domain d1rl2a2: 1rl2 A:60-125 [25342]
   Other proteins in same PDB: d1rl2a1, d1rl2b1

Details for d1rl2a2

PDB Entry: 1rl2, 2.3 Å

PDB Description: ribosomal protein l2 rna-binding domain from bacillus stearothermophilus

PDB Compounds: (A:) protein (ribosomal protein l2)

SCOPe Domain Sequences for d1rl2a2:

Sequence; same for both SEQRES and ATOM records:

>d1rl2a2 b.40.4.5 (A:60-125) N-terminal domain of ribosomal protein L2 {Bacillus stearothermophilus [TaxId: 1422]}
qyriidfkrdkdgipgrvatieydpnrsanialinyadgekryiiapknlkvgmeimsgp
dadiki

Timeline for d1rl2a2:

• d1rl2a2 first appeared (with stable ids) in SCOP 1.55
  
• d1rl2a2 appears in SCOPe 2.04
  
• d1rl2a2 appears in SCOPe 2.06
  
• d1rl2a2 appears in the current release, SCOPe 2.08