Lineage for d1rl2a2 (1rl2 A:60-125)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 296800Fold b.40: OB-fold [50198] (9 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 297373Superfamily b.40.4: Nucleic acid-binding proteins [50249] (11 families) (S)
  5. 297600Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (16 proteins)
    barrel, closed; n=5, S=8
  6. 297648Protein N-terminal domain of ribosomal protein L2 [50299] (2 species)
    lacks the last strand
  7. 297662Species Bacillus stearothermophilus [TaxId:1422] [50300] (1 PDB entry)
  8. 297663Domain d1rl2a2: 1rl2 A:60-125 [25342]
    Other proteins in same PDB: d1rl2a1, d1rl2b1

Details for d1rl2a2

PDB Entry: 1rl2 (more details), 2.3 Å

PDB Description: ribosomal protein l2 rna-binding domain from bacillus stearothermophilus

SCOP Domain Sequences for d1rl2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rl2a2 b.40.4.5 (A:60-125) N-terminal domain of ribosomal protein L2 {Bacillus stearothermophilus}
qyriidfkrdkdgipgrvatieydpnrsanialinyadgekryiiapknlkvgmeimsgp
dadiki

SCOP Domain Coordinates for d1rl2a2:

Click to download the PDB-style file with coordinates for d1rl2a2.
(The format of our PDB-style files is described here.)

Timeline for d1rl2a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rl2a1