Class b: All beta proteins [48724] (93 folds) |
Fold b.40: OB-fold [50198] (7 superfamilies) |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families) |
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (9 proteins) |
Protein N-terminal domain of ribosomal protein L2 [50299] (2 species) |
Species Bacillus stearothermophilus [TaxId:1422] [50300] (1 PDB entry) |
Domain d1rl2a2: 1rl2 A:60-125 [25342] Other proteins in same PDB: d1rl2a1, d1rl2b1 |
PDB Entry: 1rl2 (more details), 2.3 Å
SCOP Domain Sequences for d1rl2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rl2a2 b.40.4.5 (A:60-125) N-terminal domain of ribosomal protein L2 {Bacillus stearothermophilus} qyriidfkrdkdgipgrvatieydpnrsanialinyadgekryiiapknlkvgmeimsgp dadiki
Timeline for d1rl2a2: