SCOPe 2.08: Domain d4kroc1: 4kro C:1-107

Lineage for d4kroc1 (4kro C:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d4kroc1: 4kro C:1-107 [253410]
   Other proteins in same PDB: d4krob2
   automated match to d4m43l1
   complexed with nag

Details for d4kroc1

PDB Entry: 4kro, 3.05 Å

PDB Description: nanobody/vhh domain ega1 in complex with the extracellular region of egfr

PDB Compounds: (C:) Cetuximab light chain

SCOPe Domain Sequences for d4kroc1:

Sequence; same for both SEQRES and ATOM records:

>d4kroc1 b.1.1.0 (C:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dilltqspvilsvspgervsfscrasqsigtnihwyqqrtngsprllikyasesisgips
rfsgsgsgtdftlsinsvesediadyycqqnnnwpttfgagtklelk

Timeline for d4kroc1:

• d4kroc1 first appeared in SCOPe 2.04
  
• d4kroc1 appears in SCOPe 2.07