| Class b: All beta proteins [48724] (174 folds) |
| Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families) ![]() |
| Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (30 proteins) barrel, closed; n=5, S=8 |
| Protein C-terminal domain of eukaryotic initiation translation factor 5a (eIF5a) [50296] (5 species) |
| Species Archaeon Pyrobaculum aerophilum [TaxId:13773] [50298] (1 PDB entry) |
| Domain d1bkba2: 1bkb A:75-139 [25341] Other proteins in same PDB: d1bkba1 CASP3 mutant |
PDB Entry: 1bkb (more details), 1.75 Å
SCOP Domain Sequences for d1bkba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bkba2 b.40.4.5 (A:75-139) C-terminal domain of eukaryotic initiation translation factor 5a (eIF5a) {Archaeon Pyrobaculum aerophilum [TaxId: 13773]}
iiekftaqilsvsgdviqlmdmrdyktievpmkyveeeakgrlapgaevevwqildryki
irvkg
Timeline for d1bkba2: