Lineage for d1bkb_2 (1bkb 75-139)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13574Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 14052Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families) (S)
  5. 14165Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (9 proteins)
  6. 14166Protein C-terminal domain of eukaryotic initiation translation factor 5a [50296] (2 species)
  7. 14170Species Pyrobaculum aerophilum [TaxId:13773] [50298] (1 PDB entry)
  8. 14171Domain d1bkb_2: 1bkb 75-139 [25341]
    Other proteins in same PDB: d1bkb_1

Details for d1bkb_2

PDB Entry: 1bkb (more details), 1.75 Å

PDB Description: initiation factor 5a from archebacterium pyrobaculum aerophilum

SCOP Domain Sequences for d1bkb_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bkb_2 b.40.4.5 (75-139) C-terminal domain of eukaryotic initiation translation factor 5a {Pyrobaculum aerophilum}
iiekftaqilsvsgdviqlmdmrdyktievpmkyveeeakgrlapgaevevwqildryki
irvkg

SCOP Domain Coordinates for d1bkb_2:

Click to download the PDB-style file with coordinates for d1bkb_2.
(The format of our PDB-style files is described here.)

Timeline for d1bkb_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bkb_1