![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.40: OB-fold [50198] (7 superfamilies) |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families) ![]() |
![]() | Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (9 proteins) |
![]() | Protein C-terminal domain of eukaryotic initiation translation factor 5a [50296] (2 species) |
![]() | Species Pyrobaculum aerophilum [TaxId:13773] [50298] (1 PDB entry) |
![]() | Domain d1bkb_2: 1bkb 75-139 [25341] Other proteins in same PDB: d1bkb_1 |
PDB Entry: 1bkb (more details), 1.75 Å
SCOP Domain Sequences for d1bkb_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bkb_2 b.40.4.5 (75-139) C-terminal domain of eukaryotic initiation translation factor 5a {Pyrobaculum aerophilum} iiekftaqilsvsgdviqlmdmrdyktievpmkyveeeakgrlapgaevevwqildryki irvkg
Timeline for d1bkb_2: