![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (31 species) not a true protein |
![]() | Species Llama (Lama glama) [TaxId:9844] [189241] (37 PDB entries) |
![]() | Domain d4krob1: 4kro B:6-128 [253409] Other proteins in same PDB: d4krob2 automated match to d3lh2i_ complexed with nag |
PDB Entry: 4kro (more details), 3.05 Å
SCOPe Domain Sequences for d4krob1:
Sequence, based on SEQRES records: (download)
>d4krob1 b.1.1.0 (B:6-128) automated matches {Llama (Lama glama) [TaxId: 9844]} esggglvqpggslrlscaasgrtfssyamgwfrqapgkqrefvaairwsggytyytdsvk grftisrdnakttvylqmnslkpedtavyycaatylssdysryalpqrpldydywgqgtq vtv
>d4krob1 b.1.1.0 (B:6-128) automated matches {Llama (Lama glama) [TaxId: 9844]} eslscaasgrtfssyamgwfrqapgkqrefvaairwsggytyytdsvkgrftisrdnakt tvylqmnslkpedtavyycaatylssdysryalpqrpldydywgqgtqvtv
Timeline for d4krob1: