Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.39: Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) [52732] (1 superfamily) 3 layers: a/b/a, parallel beta-sheet of 7 strands, order 3214567 |
Superfamily c.39.1: Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) [52733] (2 families) |
Family c.39.1.1: Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) [52734] (2 proteins) automatically mapped to Pfam PF02277 |
Protein automated matches [190818] (3 species) not a true protein |
Species Salmonella enterica [TaxId:99287] [237634] (6 PDB entries) |
Domain d4kqga_: 4kqg A: [253406] automated match to d4kqfa_ complexed with dmd, edo, po4 |
PDB Entry: 4kqg (more details), 1.9 Å
SCOPe Domain Sequences for d4kqga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kqga_ c.39.1.1 (A:) automated matches {Salmonella enterica [TaxId: 99287]} tlhallrdipapdaeamaraqqhidgllkppgslgrletlavqlagmpglngtpqvgeka vlvmcadhgvwdegvavspkivtaiqaanmtrgttgvcvlaaqagakvhvidvgidaepi pgvvnmrvargcgniavgpamsrlqaealllevsrytcdlaqrgvtlfgvgalgmanttp aaamvsvftgsdakevvgiganlppsridnkvdvvrraiainqpnprdgidvlskvggfd lvgmtgvmlgaarcglpvlldgflsysaalaacqiapavrpylipshfsaekgarialah lsmepylhmamrlgegsgaalampiveaacamfhnmgelaasnivlp
Timeline for d4kqga_: