SCOPe 2.06: Domain d4kqga_: 4kqg A:

Lineage for d4kqga_ (4kqg A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.39: Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) [52732] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 7 strands, order 3214567

4. Superfamily c.39.1: Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) [52733] (2 families)

5. Family c.39.1.1: Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) [52734] (2 proteins)
   automatically mapped to Pfam PF02277

6. Protein automated matches [190818] (3 species)
   not a true protein

7. Species Salmonella enterica [TaxId:99287] [237634] (6 PDB entries)

8. Domain d4kqga_: 4kqg A: [253406]
   automated match to d4kqfa_
   complexed with dmd, edo, po4

Details for d4kqga_

PDB Entry: 4kqg, 1.9 Å

PDB Description: Crystal structure of CobT E174A complexed with DMB

PDB Compounds: (A:) Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase

SCOPe Domain Sequences for d4kqga_:

Sequence; same for both SEQRES and ATOM records:

>d4kqga_ c.39.1.1 (A:) automated matches {Salmonella enterica [TaxId: 99287]}
tlhallrdipapdaeamaraqqhidgllkppgslgrletlavqlagmpglngtpqvgeka
vlvmcadhgvwdegvavspkivtaiqaanmtrgttgvcvlaaqagakvhvidvgidaepi
pgvvnmrvargcgniavgpamsrlqaealllevsrytcdlaqrgvtlfgvgalgmanttp
aaamvsvftgsdakevvgiganlppsridnkvdvvrraiainqpnprdgidvlskvggfd
lvgmtgvmlgaarcglpvlldgflsysaalaacqiapavrpylipshfsaekgarialah
lsmepylhmamrlgegsgaalampiveaacamfhnmgelaasnivlp

Timeline for d4kqga_:

• d4kqga_ first appeared in SCOPe 2.04
  
• d4kqga_ appears in SCOPe 2.05
  
• d4kqga_ appears in SCOPe 2.07
  
• d4kqga_ appears in the current release, SCOPe 2.08