Lineage for d4kpka_ (4kpk A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2112071Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2112072Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2113065Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2113066Protein automated matches [190246] (54 species)
    not a true protein
  7. 2113618Species Shewanella pealeana [TaxId:398579] [256345] (1 PDB entry)
  8. 2113619Domain d4kpka_: 4kpk A: [253405]
    automated match to d4olqe_
    complexed with edo

Details for d4kpka_

PDB Entry: 4kpk (more details), 2.09 Å

PDB Description: Crystal structure of a enoyl-CoA hydratase from Shewanella pealeana ATCC 700345
PDB Compounds: (A:) enoyl-CoA hydratase/isomerase

SCOPe Domain Sequences for d4kpka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kpka_ c.14.1.0 (A:) automated matches {Shewanella pealeana [TaxId: 398579]}
atqteildqqlhylsctlnggvaqmvldrsdkhnafdevmisemiqvlehfkrneqcqil
llkangknfsagadlnwmrkqakmdfeqnladanelarlmsmldkfpkptitlvqgaafg
galgliccsdiaianerasfclsevklglipavispyvtramgqraarrymltaerfdaq
kalelqiihdinddldaaaqpfidallsnspqgmawvkcllssledgvidqntldhtser
iarirvseegqeglnaffekrspqw

SCOPe Domain Coordinates for d4kpka_:

Click to download the PDB-style file with coordinates for d4kpka_.
(The format of our PDB-style files is described here.)

Timeline for d4kpka_: