SCOPe 2.03: Domain d1eifa2: 1eif A:74-133

Lineage for d1eifa2 (1eif A:74-133)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
   barrel, closed; n=5, S=8

6. Protein C-terminal domain of eukaryotic initiation translation factor 5a (eIF5a) [50296] (5 species)

7. Species Methanococcus jannaschii [TaxId:2190] [50297] (2 PDB entries)

8. Domain d1eifa2: 1eif A:74-133 [25340]
   Other proteins in same PDB: d1eifa1

Details for d1eifa2

PDB Entry: 1eif, 1.9 Å

PDB Description: eukaryotic translation initiation factor 5a from methanococcus jannaschii

PDB Compounds: (A:) eukaryotic translation initiation factor 5a

SCOPe Domain Sequences for d1eifa2:

Sequence; same for both SEQRES and ATOM records:

>d1eifa2 b.40.4.5 (A:74-133) C-terminal domain of eukaryotic initiation translation factor 5a (eIF5a) {Methanococcus jannaschii [TaxId: 2190]}
idrrkgqvlaimgdmvqimdlqtyetlelpipegieglepggeveyieavgqykitrvig

Timeline for d1eifa2:

• d1eifa2 first appeared (with stable ids) in SCOP 1.55, called d1eif_2
  
• d1eifa2 appears in SCOPe 2.02
  
• d1eifa2 appears in SCOPe 2.04
  
• d1eifa2 appears in the current release, SCOPe 2.08