Lineage for d4kodl1 (4kod L:18-106)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2802576Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 2802649Superfamily b.52.2: ADC-like [50692] (4 families) (S)
  5. 2802857Family b.52.2.0: automated matches [191648] (1 protein)
    not a true family
  6. 2802858Protein automated matches [191195] (10 species)
    not a true protein
  7. 2802885Species Human (Homo sapiens) [TaxId:9606] [255865] (6 PDB entries)
  8. 2802919Domain d4kodl1: 4kod L:18-106 [253399]
    Other proteins in same PDB: d4koda2, d4koda3, d4kodb2, d4kodb3, d4kodc2, d4kodc3, d4kodd2, d4kodd3, d4kode2, d4kode3, d4kodf2, d4kodf3, d4kodg2, d4kodg3, d4kodh2, d4kodh3, d4kodi2, d4kodi3, d4kodj2, d4kodj3, d4kodk2, d4kodk3, d4kodl2, d4kodl3
    automated match to d1e32a1
    complexed with adp; mutant

Details for d4kodl1

PDB Entry: 4kod (more details), 2.96 Å

PDB Description: Structure of p97 N-D1 R155H mutant in complex with ADP
PDB Compounds: (L:) Transitional endoplasmic reticulum ATPase

SCOPe Domain Sequences for d4kodl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kodl1 b.52.2.0 (L:18-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kqknrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddtc
sdekirmnrvvrnnlrvrlgdvisiqpcp

SCOPe Domain Coordinates for d4kodl1:

Click to download the PDB-style file with coordinates for d4kodl1.
(The format of our PDB-style files is described here.)

Timeline for d4kodl1: