SCOPe 2.07: Domain d4kodi1: 4kod I:20-106

Lineage for d4kodi1 (4kod I:20-106)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
   barrel, closed; n=6, S=10; complex topology with crossover (psi) loops

4. Superfamily b.52.2: ADC-like [50692] (4 families)

5. Family b.52.2.0: automated matches [191648] (1 protein)
   not a true family

6. Protein automated matches [191195] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255865] (6 PDB entries)

8. Domain d4kodi1: 4kod I:20-106 [253390]
   Other proteins in same PDB: d4koda2, d4koda3, d4kodb2, d4kodb3, d4kodc2, d4kodc3, d4kodd2, d4kodd3, d4kode2, d4kode3, d4kodf2, d4kodf3, d4kodg2, d4kodg3, d4kodh2, d4kodh3, d4kodi2, d4kodi3, d4kodj2, d4kodj3, d4kodk2, d4kodk3, d4kodl2, d4kodl3
   automated match to d1e32a1
   complexed with adp; mutant

Details for d4kodi1

PDB Entry: 4kod, 2.96 Å

PDB Description: Structure of p97 N-D1 R155H mutant in complex with ADP

PDB Compounds: (I:) Transitional endoplasmic reticulum ATPase

SCOPe Domain Sequences for d4kodi1:

Sequence; same for both SEQRES and ATOM records:

>d4kodi1 b.52.2.0 (I:20-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
knrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddtcsd
ekirmnrvvrnnlrvrlgdvisiqpcp

Timeline for d4kodi1:

• d4kodi1 first appeared in SCOPe 2.04
  
• d4kodi1 appears in SCOPe 2.06
  
• d4kodi1 appears in the current release, SCOPe 2.08