Lineage for d4kodh2 (4kod H:107-200)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2549324Fold d.31: Cdc48 domain 2-like [54584] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2549325Superfamily d.31.1: Cdc48 domain 2-like [54585] (2 families) (S)
  5. 2549389Family d.31.1.0: automated matches [254296] (1 protein)
    not a true family
  6. 2549390Protein automated matches [254681] (3 species)
    not a true protein
  7. 2549398Species Human (Homo sapiens) [TaxId:9606] [255866] (6 PDB entries)
  8. 2549428Domain d4kodh2: 4kod H:107-200 [253388]
    Other proteins in same PDB: d4koda1, d4koda3, d4kodb1, d4kodb3, d4kodc1, d4kodc3, d4kodd1, d4kodd3, d4kode1, d4kode3, d4kodf1, d4kodf3, d4kodg1, d4kodg3, d4kodh1, d4kodh3, d4kodi1, d4kodi3, d4kodj1, d4kodj3, d4kodk1, d4kodk3, d4kodl1, d4kodl3
    automated match to d1e32a3
    complexed with adp; mutant

Details for d4kodh2

PDB Entry: 4kod (more details), 2.96 Å

PDB Description: Structure of p97 N-D1 R155H mutant in complex with ADP
PDB Compounds: (H:) Transitional endoplasmic reticulum ATPase

SCOPe Domain Sequences for d4kodh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kodh2 d.31.1.0 (H:107-200) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvkygkrihvlpiddtvegitgnlfevylkpyfleayrpirkgdiflvhggmravefkvv
etdpspycivapdtvihcegepikredeeeslne

SCOPe Domain Coordinates for d4kodh2:

Click to download the PDB-style file with coordinates for d4kodh2.
(The format of our PDB-style files is described here.)

Timeline for d4kodh2: