Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.20: Extended AAA-ATPase domain [81269] (43 proteins) fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain |
Protein automated matches [190766] (8 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255867] (6 PDB entries) |
Domain d4ko8a3: 4ko8 A:201-469 [253362] Other proteins in same PDB: d4ko8a1, d4ko8a2, d4ko8b1, d4ko8b2 automated match to d1e32a2 complexed with ags, mg; mutant |
PDB Entry: 4ko8 (more details), 1.98 Å
SCOPe Domain Sequences for d4ko8a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ko8a3 c.37.1.20 (A:201-469) automated matches {Human (Homo sapiens) [TaxId: 9606]} vgyddiggcrkqlaqikemvelplrhpalfkaigvkpprgillygppgtgktliaravan etgaffflingpeimsklagesesnlrkafeeaeknapaiifideldaiapkrekthgev errivsqlltlmdglkqrahvivmaatnrpnsidpalrrfgrfdrevdigipdatgrlei lqihtknmkladdvdleqvanethghvgadlaalcseaalqairkkmdlidledetidae vmnslavtmddfrwalsqsnpsalretvv
Timeline for d4ko8a3: