SCOPe 2.08: Domain d4ko8a2: 4ko8 A:107-200

Lineage for d4ko8a2 (4ko8 A:107-200)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.31: Cdc48 domain 2-like [54584] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.31.1: Cdc48 domain 2-like [54585] (2 families)

5. Family d.31.1.0: automated matches [254296] (1 protein)
   not a true family

6. Protein automated matches [254681] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255866] (6 PDB entries)

8. Domain d4ko8a2: 4ko8 A:107-200 [253361]
   Other proteins in same PDB: d4ko8a1, d4ko8a3, d4ko8b1, d4ko8b3
   automated match to d1e32a3
   complexed with ags, mg; mutant

Details for d4ko8a2

PDB Entry: 4ko8, 1.98 Å

PDB Description: Structure of p97 N-D1 R155H mutant in complex with ATPgS

PDB Compounds: (A:) Transitional endoplasmic reticulum ATPase

SCOPe Domain Sequences for d4ko8a2:

Sequence; same for both SEQRES and ATOM records:

>d4ko8a2 d.31.1.0 (A:107-200) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvkygkrihvlpiddtvegitgnlfevylkpyfleayrpirkgdiflvhggmravefkvv
etdpspycivapdtvihcegepikredeeeslne

Timeline for d4ko8a2:

• d4ko8a2 first appeared in SCOPe 2.04
  
• d4ko8a2 appears in SCOPe 2.07