SCOPe 2.05: Domain d4knue1: 4knu E:25-153

Lineage for d4knue1 (4knu E:25-153)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.0: automated matches [191502] (1 protein)
   not a true family

6. Protein automated matches [190824] (21 species)
   not a true protein

7. Species Nitrosomonas europaea [TaxId:228410] [235189] (3 PDB entries)

8. Domain d4knue1: 4knu E:25-153 [253356]
   automated match to d4kntc1
   complexed with cl, cu, gol

Details for d4knue1

PDB Entry: 4knu, 1.8 Å

PDB Description: Copper nitrite reductase from Nitrosomonas europaea at pH 6.5

PDB Compounds: (E:) Multicopper oxidase type 1

SCOPe Domain Sequences for d4knue1:

Sequence; same for both SEQRES and ATOM records:

>d4knue1 b.6.1.0 (E:25-153) automated matches {Nitrosomonas europaea [TaxId: 228410]}
ktvqvtlhavetdvaydnkgstyrawtfdgkvpgpvvrvtegdtveftlindknsknshs
mdfhaarldvvedfesikpgetkkytftadnpgvffyhcgsdpmiqhiargmygviivdp
kdanalpka

Timeline for d4knue1:

• d4knue1 first appeared in SCOPe 2.04
  
• d4knue1 appears in SCOPe 2.06
  
• d4knue1 appears in the current release, SCOPe 2.08