Lineage for d4knub2 (4knu B:154-309)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1527467Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1527468Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1528843Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 1528844Protein automated matches [190824] (20 species)
    not a true protein
  7. 1529014Species Nitrosomonas europaea [TaxId:228410] [235189] (3 PDB entries)
  8. 1529018Domain d4knub2: 4knu B:154-309 [253351]
    automated match to d4kntc2
    complexed with cl, cu, gol

Details for d4knub2

PDB Entry: 4knu (more details), 1.8 Å

PDB Description: Copper nitrite reductase from Nitrosomonas europaea at pH 6.5
PDB Compounds: (B:) Multicopper oxidase type 1

SCOPe Domain Sequences for d4knub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4knub2 b.6.1.0 (B:154-309) automated matches {Nitrosomonas europaea [TaxId: 228410]}
dreyvliqaehyenpddktammqnkwsnvvfnggvfkydpvhdseatswlqakpgervri
yfvnagpnelsslhpiagiwdrvypsgnpknvqyalqsyligagdaatldlispvegana
ivdhsmrhahsgaiavimftndadpeagrgenilir

SCOPe Domain Coordinates for d4knub2:

Click to download the PDB-style file with coordinates for d4knub2.
(The format of our PDB-style files is described here.)

Timeline for d4knub2: