Lineage for d4knaa_ (4kna A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2141090Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2141091Protein automated matches [190683] (49 species)
    not a true protein
  7. 2141237Species Burkholderia thailandensis [TaxId:271848] [256344] (2 PDB entries)
  8. 2141238Domain d4knaa_: 4kna A: [253341]
    automated match to d3ju8a_
    complexed with ca, cl, edo

Details for d4knaa_

PDB Entry: 4kna (more details), 1.95 Å

PDB Description: Crystal structure of an N-succinylglutamate 5-semialdehyde dehydrogenase from Burkholderia thailandensis
PDB Compounds: (A:) N-succinylglutamate 5-semialdehyde dehydrogenase

SCOPe Domain Sequences for d4knaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4knaa_ c.82.1.0 (A:) automated matches {Burkholderia thailandensis [TaxId: 271848]}
mtelfidgawvdgagpvfasrnpgtnervwegasasaddveravasarrafaawsaldld
arctivkrfaallverkealatmigretgkplweartevasmaakvdisitayhertgek
rapmadgvavlrhrphgvvavfgpynfpghlpnghivpaliagntvvfkpselapgvara
tveiwrdaglpagvlnlvqgekdtgvalanhrqidglfftgssdtgtllhkqfggrpeiv
lalemggnnplvvaevedidaavhhaiqsaflsagqrctcarrilvprgafgdrfvarla
dvaskitasvfdadpqpfmgavisaraasrlvaaqarlvglgaspiiemkqrdpalgfvn
aaildvtnvrelpdeehfgplaqivrytdlddaiarandtafglsaglladdeqawhtfr
rairagivnwnrptngassaapfggagrsgnhrpsayyaadycaypmasvesaqlqmpas
lspglhf

SCOPe Domain Coordinates for d4knaa_:

Click to download the PDB-style file with coordinates for d4knaa_.
(The format of our PDB-style files is described here.)

Timeline for d4knaa_: