Lineage for d4klne2 (4kln E:107-200)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1645081Fold d.31: Cdc48 domain 2-like [54584] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 1645082Superfamily d.31.1: Cdc48 domain 2-like [54585] (2 families) (S)
  5. 1645121Family d.31.1.0: automated matches [254296] (1 protein)
    not a true family
  6. 1645122Protein automated matches [254681] (1 species)
    not a true protein
  7. 1645123Species Human (Homo sapiens) [TaxId:9606] [255866] (6 PDB entries)
  8. 1645144Domain d4klne2: 4kln E:107-200 [253331]
    Other proteins in same PDB: d4klna1, d4klna3, d4klnb1, d4klnb3, d4klnc1, d4klnc3, d4klnd1, d4klnd3, d4klne1, d4klne3, d4klnf1, d4klnf3
    automated match to d1e32a3
    complexed with ags, mg; mutant

Details for d4klne2

PDB Entry: 4kln (more details), 2.62 Å

PDB Description: Structure of p97 N-D1 A232E mutant in complex with ATPgS
PDB Compounds: (E:) Transitional endoplasmic reticulum ATPase

SCOPe Domain Sequences for d4klne2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4klne2 d.31.1.0 (E:107-200) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvkygkrihvlpiddtvegitgnlfevylkpyfleayrpirkgdiflvrggmravefkvv
etdpspycivapdtvihcegepikredeeeslne

SCOPe Domain Coordinates for d4klne2:

Click to download the PDB-style file with coordinates for d4klne2.
(The format of our PDB-style files is described here.)

Timeline for d4klne2: